PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00002.1.g16040.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family bZIP
Protein Properties Length: 660aa    MW: 71607.5 Da    PI: 9.9909
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00002.1.g16040.1.am.mkgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_130.48.7e-10525577557
                                   CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                        bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkeva 57 
                                   kr +r   NR +A rs +RK  +++eLe+kv+ L++e ++L  +l  l+  +a
  Zjn_sc00002.1.g16040.1.am.mk 525 KRVKRVLANRQSAARSKERKMRYMAELEQKVQILQTEATTLSAQLTLLQRDSA 577
                                   999*****************************************999987766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003384.4E-16521585IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.576523586IPR004827Basic-leucine zipper domain
SuperFamilySSF579597.74E-11525575No hitNo description
Gene3DG3DSA:1.20.5.1701.8E-9525577No hitNo description
PfamPF001707.6E-9525577IPR004827Basic-leucine zipper domain
CDDcd147031.39E-23526577No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 660 aa     Download sequence    Send to blast
MDFVVGSFGR SIDLCNAWPL TPTFSWLASG GHGARSINSS TFRRYLLLRD GDARSASIIF  60
RDPHDDGAGL LAIQSTYAFC SNSGGGRGAK THRTFRLSDS SYPAVIVLDR AGLLAHVRLY  120
KSGDVIGTTS SPPRTARITC TPCACMTAWA PRGFSPEESL SFPNRFLPHH RLLPPRFTFP  180
SSFNPRAWRR SLLCSSLFDS SSTPTRVDAE ATEAVRAVNK QTEGQPNGAL KAPARAKHRS  240
IRFHRRPPRL HRQRQRSNGT SPPPPWSFRA TMNGAADAHA ASLMQQELLQ AARLQQQPPQ  300
GMTSSMPTSN KPRLPGLPPT PPQRALDACM DVDPAARNTA HRRSRSDVPF DYFPPPKVEA  360
GWGGGQDDAD DLFDSYLNLD GLDGVNNSSE ERRDDGDSRG SSMKTNGADS SENESEEGAA  420
ADSRAAGIRL WAAGGVEGLN KRGGPGGQPG AAPAPRHARS LSMDSLIGNG KFNFAAGGMT  480
SGANGIMPGP NRFSLEFGSG EFTPAEMKKI MADEKLAEMA LADPKRVKRV LANRQSAARS  540
KERKMRYMAE LEQKVQILQT EATTLSAQLT LLQRDSAGIA TQNSELQFRI RAMEQQAQLR  600
DAVFVNVRCA KHERRLAVVL DTCSLEKLYP AAGVDDDMLA CPRPVRGCSL TGHGSESRVQ
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP35363576
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G21230.11e-40bZIP family protein